DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and elavl3

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_012808614.1 Gene:elavl3 / 594912 XenbaseID:XB-GENE-490864 Length:363 Species:Xenopus tropicalis


Alignment Length:281 Identity:101/281 - (35%)
Similarity:138/281 - (49%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QQENGDGG----NGGDGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDM 104
            |..||.|.    ||.:|   :.|:                           |.||||:|||||:|
 Frog    12 QASNGPGSVGILNGTNG---AADD---------------------------SKTNLIVNYLPQNM 46

  Fly   105 TDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYA 169
            |..|..:||...|.|.:||::||..||.|.|||||:|...:|::.||..|||..::.|.:|||||
 Frog    47 TQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYA 111

  Fly   170 RPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGR-PRGVAFVRYNKREEA 233
            ||...||:|.||||.:|.:.:|...::::||.||.|:...||.|::||. .|||.|:|::||.||
 Frog   112 RPSSASIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITSRILVDQVTGSVSRGVGFIRFDKRIEA 176

  Fly   234 QEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHH 298
            :||||.||...|.|.|:||.|:.|....: |..|.:.                            
 Frog   177 EEAIKGLNGQKPLGASEPITVKFANNPSQ-KTGQALL---------------------------- 212

  Fly   299 NNHHHNNHHNPHMPPHHHQPQ 319
             .|.:......:..|.|||.|
 Frog   213 -THLYQTTARRYTGPLHHQTQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 43/79 (54%)
RRM_SF 179..257 CDD:302621 37/78 (47%)
elavl3XP_012808614.1 ELAV_HUD_SF 32..362 CDD:273741 93/258 (36%)
RRM1_Hu 34..111 CDD:241094 39/76 (51%)
RRM_SF 116..206 CDD:302621 41/90 (46%)
RRM3_HuC 279..363 CDD:241099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.