DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and RBMY1A1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_005049.1 Gene:RBMY1A1 / 5940 HGNCID:9912 Length:496 Species:Homo sapiens


Alignment Length:303 Identity:59/303 - (19%)
Similarity:107/303 - (35%) Gaps:90/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYV 159
            |.|..|.::..::.|..:|...|||:...:::| :|..|.|:.|:.::..:|:::|.:.:||..:
Human    10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSL 73

  Fly   160 RNKRLKVSYAR-----PGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRP 219
            ..|.:||..|:     .||:.....:      |||         .||.|.:......|    |..
Human    74 HGKAIKVEQAKKPSFQSGGRRRPPAS------SRN---------RSPSGSLRSARGSR----GGT 119

  Fly   220 RGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPP 284
            ||              .:.:....:.:||..|. ::::...|       :..:..|.....||||
Human   120 RG--------------WLPSHEGHLDDGGYTPD-LKMSYSRG-------LIPVKRGPSSRSGGPP 162

  Fly   285 --------------HMGPGGPMH--------PPHH-----HNNHHHNNHHNPHMPPHHHQPQHPH 322
                          .||..|||.        ||..     ..|...:..|:.:.           
Human   163 PKKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYA----------- 216

  Fly   323 QHPQHHPQLHHMQHHHPNN-----HNNNHPNNHHHNNNNNNHH 360
            .:..:||.....:.:.|.:     .:|.|.|...|::....:|
Human   217 TNDGNHPSCQETRDYAPPSRGYAYRDNGHSNRDEHSSRGYRNH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/82 (26%)
RRM_SF 179..257 CDD:302621 13/77 (17%)
RBMY1A1NP_005049.1 RRM <1..189 CDD:223796 47/220 (21%)
RRM_RBMX_like 7..85 CDD:240828 21/75 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..349 41/234 (18%)
RBM1CTR 174..218 CDD:285341 9/54 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.