Sequence 1: | NP_569908.1 | Gene: | ssx / 31086 | FlyBaseID: | FBgn0024987 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006719604.1 | Gene: | RBMS2 / 5939 | HGNCID: | 9909 | Length: | 477 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 61/206 - (29%) |
---|---|---|---|
Similarity: | 93/206 - (45%) | Gaps: | 18/206 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 SQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGY 132
Fly 133 SFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDR 197
Fly 198 IFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNN---TVPEG---GSQPIWVRL 256
Fly 257 AEEHGKAKAAQ 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssx | NP_569908.1 | RRM_SF | 93..173 | CDD:302621 | 26/79 (33%) |
RRM_SF | 179..257 | CDD:302621 | 26/83 (31%) | ||
RBMS2 | XP_006719604.1 | RRM1_MSSP1 | 49..134 | CDD:240914 | 27/88 (31%) |
RRM2_MSSP2 | 135..220 | CDD:240918 | 27/85 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |