DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and RBMS2

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006719604.1 Gene:RBMS2 / 5939 HGNCID:9909 Length:477 Species:Homo sapiens


Alignment Length:206 Identity:61/206 - (29%)
Similarity:93/206 - (45%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGY 132
            |..|...::|:|....    |:.|.|||.|..|....||::|..|....|.|.:.|.:.|..|..
Human    35 SPSNSTPNSSSGSNGN----DQLSKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNK 95

  Fly   133 SFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDR 197
            ..||||||:.:.|.::.|:..|....|:.:..|.....|       ||||:.||..::::..|:.
Human    96 CKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDP-------TNLYISNLPLSMDEQELEG 153

  Fly   198 IFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNN---TVPEG---GSQPIWVRL 256
            :..|:|.::...|||| .:|..|||.|.|....|:.:..|...|.   ..|.|   .|.|:..:.
Human   154 MLKPFGQVISTRILRD-TSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPSDPLLCKF 217

  Fly   257 AEEHGKAKAAQ 267
            |:...|.:..|
Human   218 ADGGPKKRQNQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/79 (33%)
RRM_SF 179..257 CDD:302621 26/83 (31%)
RBMS2XP_006719604.1 RRM1_MSSP1 49..134 CDD:240914 27/88 (31%)
RRM2_MSSP2 135..220 CDD:240918 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.