DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and RBMS1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005246794.1 Gene:RBMS1 / 5937 HGNCID:9907 Length:422 Species:Homo sapiens


Alignment Length:187 Identity:57/187 - (30%)
Similarity:88/187 - (47%) Gaps:18/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGY 132
            |.:|..:.:::|.       |:.|.|||.|..||...||::|..|....|.|.:.|.:.|..|..
Human    44 SNNNSSSSSNSGW-------DQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNK 101

  Fly   133 SFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDR 197
            ..||||||:.:.:.::.|:..|....|:.:..|.....|       ||||:.||..::::..|:.
Human   102 CKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP-------TNLYISNLPLSMDEQELEN 159

  Fly   198 IFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNN---TVPEGGSQP 251
            :..|:|.::...||||. :|..|||.|.|....|:.:..|...|.   ..|.|.|.|
Human   160 MLKPFGQVISTRILRDS-SGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/79 (33%)
RRM_SF 179..257 CDD:302621 26/76 (34%)
RBMS1XP_005246794.1 RRM1_MSSP1 55..140 CDD:409900 28/91 (31%)
RRM2_MSSP1 141..225 CDD:409903 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.