DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and CG34354

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:506 Identity:109/506 - (21%)
Similarity:170/506 - (33%) Gaps:198/506 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EHSGDEEQHHSQDNEGNDNSAGQQQQMQQV----DRTSATNLIINYLPQDMTDRELYNLFSGCGP 118
            :|:|  :|.|||..:....|..||||.||:    .:....::.:..|..::..::|.:.|:..|.
  Fly    59 QHNG--QQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGE 121

  Fly   119 INTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIK------ 177
            |:.|:::||.:|..|.|||||.:..:|::|.||..:||.::.::.::.::|.....:.|      
  Fly   122 ISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAK 186

  Fly   178 ------------DTNLYV----IN--LSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAF 224
                        .||..|    ||  ||..:|:::|.:.|||||.|.:..:.:||      |.||
  Fly   187 PLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDK------GYAF 245

  Fly   225 VRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHG------------------------KAKA 265
            ||::.:|.|..||.|:|||  |...||:.....:|.|                        .|.|
  Fly   246 VRFSTKEAATHAIVAVNNT--EINQQPVKCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAA 308

  Fly   266 AQFMAQIGG--------------------------------GNGGG-------GGG--------- 282
            |.:..|:.|                                |...|       |.|         
  Fly   309 AAYGQQVAGYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGTWQS 373

  Fly   283 -PPH-----------------------------------------------MGP--------GGP 291
             ||.                                               :.|        |..
  Fly   374 VPPQPQLASAAAATAPQITQSVGSALPQAAGVVAYPMQQFQVSPQLAEDEWLAPSLLVXLPXGMA 438

  Fly   292 MHPPHHHNNHHHNNHHNPHM---------------PPH---------HHQPQHPHQHPQHHPQLH 332
            |:|...|............:               ||:         |||.|..|.|.||..|.|
  Fly   439 MYPTQQHQQQQQQQQQQQMLQQQHEQQTSGEYVKEPPYQTQQLQQLQHHQLQQQHSHNQHQQQQH 503

  Fly   333 HM-QHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGM 382
            :: |.::|::.............||..       .|...||..|:....||
  Fly   504 YIHQLYYPSHWVQQQQQQQQQVANNEQ-------QPQQQQQQPPVAQVYGM 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 22/79 (28%)
RRM_SF 179..257 CDD:302621 33/83 (40%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 21/73 (29%)
RRM3_TIA1_like 202..278 CDD:240800 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.