DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and rbms1a

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005155779.1 Gene:rbms1a / 564994 ZFINID:ZDB-GENE-030131-4967 Length:398 Species:Danio rerio


Alignment Length:367 Identity:91/367 - (24%)
Similarity:134/367 - (36%) Gaps:101/367 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGY 132
            |.:|..:.:|....:|:      |.|||.|..||...||.:|..|....|.|.:.|.:.|..|..
Zfish    38 STNNSSSSSSTTGWEQL------SKTNLYIRGLPPGTTDHDLVKLCQPYGKIVSTKAILDKTTNK 96

  Fly   133 SFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDR 197
            ..||||||:.:...::.|:..|....|:.:..|.....|       ||||:.||..::::..|:.
Zfish    97 CKGYGFVDFDSPVSAQKAVAALKTNGVQAQMAKQQEQDP-------TNLYLSNLPVSMDEQELEN 154

  Fly   198 IFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPE------GGSQPIWVRL 256
            :..|:|.:|...|||| ..|..|||.|.|....|:....|...|....:      |.|:|:..:.
Zfish   155 LLKPFGQVVSTRILRD-TNGMSRGVGFARMESTEKCDAVISHFNGKFIKSSSGMLGASEPLLCKF 218

  Fly   257 AEEHGKAKAAQFMAQ-IGGG------------------------NGGGGGGPPHMG------PGG 290
            |:  |..|..|..|: |..|                        ..|....|..||      || 
Zfish   219 AD--GGQKKRQSQAKYIPNGRTWTRDAEVRLSGMTLTYDPNTALQNGYYAAPYAMGNRLMTQPG- 280

  Fly   291 PMHPPHHHNNHHHNNHHNPHMPPHHHQP-QHPHQHPQHHPQLHHMQHHHPN---NHNNNHPNNHH 351
                            .:|::.|....| |:|...| |.|.:  ||  ||.   :.:..||.:..
Zfish   281 ----------------VSPYISPISTYPVQNPSWMP-HQPYI--MQ--HPGAVLSPSMEHPMSLQ 324

  Fly   352 HN------NNNNNHHNMGG----------------PHPHHMQ 371
            .:      .....|.::||                ||..|:|
Zfish   325 PSAMLAPLTQQMGHLSLGGTATFIPANTAMPGAYIPHYTHIQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/79 (33%)
RRM_SF 179..257 CDD:302621 26/83 (31%)
rbms1aXP_005155779.1 RRM_SF 50..135 CDD:302621 27/90 (30%)
RRM_SF 136..221 CDD:302621 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.