DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and cirbp

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:126 Identity:35/126 - (27%)
Similarity:64/126 - (50%) Gaps:17/126 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKA 239
            |..:..|:|..|:....::.|:::||.||.:.:..:::|:.:.|.||..||.:...|:|::|:.|
 Frog     2 SCDEGKLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMA 66

  Fly   240 LNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGG----------GGGGPPHMGPGG 290
            :|....:|..    :|: ::.||:...:.....||.:||          ||||  ..|.||
 Frog    67 MNGKSVDGRQ----IRV-DQAGKSSNDRRGGYRGGSSGGRGFFRGGRGRGGGG--DRGYGG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621
RRM_SF 179..257 CDD:302621 21/77 (27%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 22/83 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.