DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and RBM11

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:118 Identity:32/118 - (27%)
Similarity:51/118 - (43%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSED 149
            ::.|||    :.:..|...:.:..||.||...||:....|.:| :.|....:|||.:|.......
Human     6 EEADRT----VFVGNLEARVREEILYELFLQAGPLTKVTICKD-REGKPKSFGFVCFKHPESVSY 65

  Fly   150 AIQKLNGFYVRNKRLKVSY-------ARPGGQSIKDTNLYVINLSRNINDDML 195
            ||..|||..:..:.:.|.|       :.|..||.:  :...||.....|::||
Human    66 AIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFE--SCVKINSHNYRNEEML 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 22/86 (26%)
RRM_SF 179..257 CDD:302621 5/17 (29%)
RBM11NP_001307531.1 RRM <5..139 CDD:223796 32/118 (27%)
RRM_RBM11 9..83 CDD:241037 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.