Sequence 1: | NP_569908.1 | Gene: | ssx / 31086 | FlyBaseID: | FBgn0024987 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_112241.2 | Gene: | PABPC3 / 5042 | HGNCID: | 8556 | Length: | 631 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 61/203 - (30%) |
---|---|---|---|
Similarity: | 102/203 - (50%) | Gaps: | 29/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 NLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFY 158
Fly 159 VRNKRLKVSYA-----------RPGGQSIKD-------TNLYVINLSRNINDDMLDRIFSPYGLI 205
Fly 206 VQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKA----- 265
Fly 266 -AQFMAQI 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssx | NP_569908.1 | RRM_SF | 93..173 | CDD:302621 | 27/89 (30%) |
RRM_SF | 179..257 | CDD:302621 | 26/77 (34%) | ||
PABPC3 | NP_112241.2 | PABP-1234 | 11..610 | CDD:130689 | 61/203 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |