powered by:
Protein Alignment ssx and AT5G03495
DIOPT Version :9
Sequence 1: | NP_569908.1 |
Gene: | ssx / 31086 |
FlyBaseID: | FBgn0024987 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078524.1 |
Gene: | AT5G03495 / 5008197 |
AraportID: | AT5G03495 |
Length: | 226 |
Species: | Arabidopsis thaliana |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 18/39 - (46%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 FSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI 151
|:.||.|....:.|||:.|......|:..|.|...|.|:
plant 53 FASCGKITHIYVPRDFERGILKSVAFMCIKGEGGEEKAL 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1202220at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.