DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AgaP_AGAP010200

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_554108.3 Gene:AgaP_AGAP010200 / 4578280 VectorBaseID:AGAP010200 Length:323 Species:Anopheles gambiae


Alignment Length:207 Identity:47/207 - (22%)
Similarity:83/207 - (40%) Gaps:46/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TSATNLIINYLPQDMTDRELYNLF----SGCGPINTCKIMRDFKTGYSFGYGFVDY--------- 141
            |..|.:|::..|:..|.|....:.    |..||..:..........:.:....:.|         
Mosquito    93 TEPTPVIVSSAPKLYTARPTVGIASKSESSSGPSTSSAPAPCISKQFQYDIANIQYEMTTKMKKP 157

  Fly   142 KTESD--------------SEDAIQKLNGFYVRNKRLKVSYAR-PGGQSIKDTNL---------- 181
            |||..              :..|:|.......|.|:.|....| .|||:.:|.:|          
Mosquito   158 KTEKSGPNPIAEEAIKAARASSALQSFGNSERRGKKDKKQLVRVAGGQTWEDMSLADWPEDDFRI 222

  Fly   182 YVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPE 246
            :..:|..::||::|.|.|:.|....:..::|||.|.:.:|..||.:   ::.|:.|:|:...  :
Mosquito   223 FCGDLGNDVNDELLTRTFNKYPSFQRAKVIRDKRTSKSKGYGFVSF---KDPQDFIRAMKEM--D 282

  Fly   247 G---GSQPIWVR 255
            |   ||:||.:|
Mosquito   283 GRYVGSRPIKLR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 18/107 (17%)
RRM_SF 179..257 CDD:302621 24/90 (27%)
AgaP_AGAP010200XP_554108.3 RRM 135..>323 CDD:223796 38/165 (23%)
RRM_RBM42 214..296 CDD:240829 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.