DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and pabpc1l

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001005062.1 Gene:pabpc1l / 448615 XenbaseID:XB-GENE-5742459 Length:629 Species:Xenopus tropicalis


Alignment Length:288 Identity:81/288 - (28%)
Similarity:130/288 - (45%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157
            ||:.|....:||.|:.|..:||..|...:.|:|.| .||.|.|:|||:|....:::.|:.::||.
 Frog   191 TNVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMD-DTGRSRGFGFVNYGNHEEAQKAVSEMNGK 254

  Fly   158 YVRNKRLKVSYA-----RPGG-----QSIKD--------TNLYVINLSRNINDDMLDRIFSPYGL 204
            .|..:.:.|..|     |.|.     :.||.        .||||.||...|:||.|.:.|||||.
 Frog   255 EVNGRMIYVGRAQKRIERQGELKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFSPYGT 319

  Fly   205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAA--- 266
            |....::.:  .|..:|..||.::..|||.:|:..:|..:.  .::|::|.||:...:.||.   
 Frog   320 ITSAKVMTE--GGHSKGFGFVCFSSPEEATKAVTEMNGRIV--STKPLYVALAQRKEERKAILTN 380

  Fly   267 QFMAQIGGGNGGGGGGPPHMG----------PGGPMHPPHHHNNHHHNNHHNPH-MPPHHHQPQ- 319
            |:|.::.......|   |.:|          |..|..|        :...::|: :.|....|| 
 Frog   381 QYMQRLATMRAMPG---PLLGSFQQPANYFLPAMPQPP--------NRTFYSPNPVAPVRQAPQW 434

  Fly   320 --HPHQHPQHHPQLHHMQHHHPNNHNNN 345
              |..:.||:.|....|:...|...::|
 Frog   435 TSHQSRPPQYQPPAPLMRAVPPRRMSSN 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 28/84 (33%)
RRM_SF 179..257 CDD:302621 27/77 (35%)
pabpc1lNP_001005062.1 PABP-1234 11..612 CDD:130689 81/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.