DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and rbms2b

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001003541.1 Gene:rbms2b / 445147 ZFINID:ZDB-GENE-040801-51 Length:400 Species:Danio rerio


Alignment Length:314 Identity:77/314 - (24%)
Similarity:125/314 - (39%) Gaps:47/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NGDGGNGGDGQEHSGDEEQ----HHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDR 107
            ||.....|..|.::...:|    ..:..:..|.:|:|.       |:.|.|||.|..|....||:
Zfish    15 NGYTSRTGKKQAYASSTQQMAPPSPNTTSSSNGSSSGG-------DQLSKTNLYIRGLHPGTTDQ 72

  Fly   108 ELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPG 172
            :|..|....|.|.:.|.:.|..|....||||||:.:.:.::.|:..|....|:.:..|.....| 
Zfish    73 DLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPASAQKAVTALKASGVQAQMAKQQEQDP- 136

  Fly   173 GQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAI 237
                  ||||:.||..::::..|:.:..|:..::...|||| ..|..|||.|.|....|:.:..|
Zfish   137 ------TNLYISNLPLSMDEQELESMLKPFSQVISTRILRD-ANGTSRGVGFARMESTEKCEAII 194

  Fly   238 KALNN---TVPEG---GSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPH 296
            :..|.   ..|.|   .::|:..:.|:...|.:..|      |.....|......|..|.|...:
Zfish   195 QHFNGKYIKTPPGVAVPTEPLLCKFADGGQKKRQNQ------GKYHQNGRQWSREGETGGMTLTY 253

  Fly   297 HHNNHHHNNHHNP-------------HMPPHHHQPQHPHQHPQHHPQ-LHHMQH 336
            .......|..::|             .:.|:.|.|...:|  .|:|. :||..:
Zfish   254 DPTPALQNGFYSPSYSIAPNRIIAQTSISPYMHSPVSTYQ--VHNPSWIHHQSY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/79 (32%)
RRM_SF 179..257 CDD:302621 24/83 (29%)
rbms2bNP_001003541.1 RRM_SF 53..136 CDD:302621 26/82 (32%)
RRM2_MSSP2 137..222 CDD:240918 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.