DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Ref1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:290 Identity:62/290 - (21%)
Similarity:94/290 - (32%) Gaps:99/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DDDSNGNMQQENGDGGNGGDGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYL 100
            ||.......|:......||.|                |...:.|||:......|..|.       
  Fly    10 DDIIKSTRSQKKPQAARGGPG----------------GARKTGGQQRFAGGARRGGAN------- 51

  Fly   101 PQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKL----------- 154
                         :|..|.....:::..:.|.:.|              |:||.           
  Fly    52 -------------AGGSPRKPGSVLKGPRGGVAAG--------------AVQKAKFPRGDVNSAW 89

  Fly   155 -NGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGR 218
             :..|...||..|     ||.| ..|.|.|.||...:::..:..:|:.:|.|.:..:..|: :||
  Fly    90 KHDMYDGPKRGAV-----GGGS-GPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGR 147

  Fly   219 PRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLA-----------------EEHGKAKAA 266
            ..|.|.|.:.:|.:|.:|||..:. ||..| :|:.::||                 ...|.....
  Fly   148 SLGTADVIFERRADALKAIKQYHG-VPLDG-RPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPT 210

  Fly   267 QFMAQIGGGNGGGG---------GGPPHMG 287
            .|  :.|||..||.         ||.|..|
  Fly   211 SF--KRGGGQAGGTARRGFKRPVGGKPAAG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 11/91 (12%)
RRM_SF 179..257 CDD:302621 23/77 (30%)
Ref1NP_651968.1 RRM <108..>187 CDD:223796 25/81 (31%)
RRM_THOC4 109..183 CDD:241124 23/76 (30%)
FoP_duplication 214..>265 CDD:290576 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.