DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and trv

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:122/262 - (46%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GGDGQEHSGDEEQH----HSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLF 113
            ||...|.|.:|.::    |.|                       .::.:..|..::..::|...|
  Fly   291 GGQDMEDSDEEMEYMPPLHKQ-----------------------FHIFVGDLSSEIETQQLREAF 332

  Fly   114 SGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYA--RP--GGQ 174
            :..|.|:.|:::||.:|..|.|||||.:..:|::|.||..:||.::.::.::.::|  :|  ..:
  Fly   333 TPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKE 397

  Fly   175 SIK--------------DTNLYV--INLSRN-INDDMLDRIFSPYGLIVQRNILRDKLTGRPRGV 222
            :||              :..:||  :|.:.. :::::|.:.|:|||.|.:..:.:||      |.
  Fly   398 NIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDK------GY 456

  Fly   223 AFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMA--QIGGGNGGGGGGPPH 285
            ||||::.:|.|..||..::||  |..:||:.....:|.|....||.:|  .:........|.|..
  Fly   457 AFVRFSTKEAATHAIVGVHNT--EINAQPVKCSWGKESGDPNNAQTIATQALNSAAAAAAGFPYG 519

  Fly   286 MG 287
            :|
  Fly   520 VG 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 23/83 (28%)
RRM_SF 179..257 CDD:302621 25/80 (31%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 21/73 (29%)
RRM3_TIA1_like 416..491 CDD:240800 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.