DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and elavl2

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001002172.2 Gene:elavl2 / 431719 ZFINID:ZDB-GENE-040704-9 Length:389 Species:Danio rerio


Alignment Length:197 Identity:86/197 - (43%)
Similarity:122/197 - (61%) Gaps:0/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVD 140
            |:.....:|......|.||||:|||||:||..||.:||...|.|.:||::||..||.|.|||||:
Zfish    51 NTCTSPVEMPNGSEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVN 115

  Fly   141 YKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLI 205
            |....|:|.||..|||..::.|.:|||||||...||:|.||||..|.:.:....|:::||.:|.|
Zfish   116 YMEPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQFGRI 180

  Fly   206 VQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMA 270
            :...||.|::||..|||.|:|:::|.||:||||.||...|.|.::||.|:.|....:..:...::
Zfish   181 ITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGATEPITVKFANNPSQKSSQALLS 245

  Fly   271 QI 272
            .:
Zfish   246 HL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 45/79 (57%)
RRM_SF 179..257 CDD:302621 34/77 (44%)
elavl2NP_001002172.2 ELAV_HUD_SF 65..388 CDD:273741 84/183 (46%)
RRM1_Hu 67..144 CDD:241094 41/76 (54%)
RRM2_HuB 149..238 CDD:241219 38/88 (43%)
RRM_SF 303..388 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.