Sequence 1: | NP_569908.1 | Gene: | ssx / 31086 | FlyBaseID: | FBgn0024987 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002172.2 | Gene: | elavl2 / 431719 | ZFINID: | ZDB-GENE-040704-9 | Length: | 389 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 86/197 - (43%) |
---|---|---|---|
Similarity: | 122/197 - (61%) | Gaps: | 0/197 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 NSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVD 140
Fly 141 YKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLI 205
Fly 206 VQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMA 270
Fly 271 QI 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssx | NP_569908.1 | RRM_SF | 93..173 | CDD:302621 | 45/79 (57%) |
RRM_SF | 179..257 | CDD:302621 | 34/77 (44%) | ||
elavl2 | NP_001002172.2 | ELAV_HUD_SF | 65..388 | CDD:273741 | 84/183 (46%) |
RRM1_Hu | 67..144 | CDD:241094 | 41/76 (54%) | ||
RRM2_HuB | 149..238 | CDD:241219 | 38/88 (43%) | ||
RRM_SF | 303..388 | CDD:302621 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000313 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |