DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Rbp4

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster


Alignment Length:410 Identity:79/410 - (19%)
Similarity:150/410 - (36%) Gaps:107/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSF 134
            |.:|:..:|.:::..:.:.:     :.|..|....|...|...||..|.:....::||..:.:|.
  Fly    14 DCKGDGKTAIKEEGYEHLRK-----IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSR 73

  Fly   135 GYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARP-------GGQS------------IKDTN 180
            |:|||.| .:..|.:.:|:.....:.||.::..:|.|       ||..            :....
  Fly    74 GFGFVTY-VDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKR 137

  Fly   181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVP 245
            :::..|....:::::...||.:|.:....:|.|:.|||.|...|:.:.....|::|:....:   
  Fly   138 IFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKH--- 199

  Fly   246 EGGSQPIWV--RLAEEHGKAKAA--QFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHHNN- 305
                   |:  .|.|.....:.|  :|...| ..:...|..||.         |...:::::|| 
  Fly   200 -------WILQTLVEVKRSTQKADRRFRFPI-FSSVRAGYIPPQ---------PATADSYNYNNP 247

  Fly   306 HHNPH-----MPP--------HHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNN 357
            ::||:     :||        |:..|..|...|.     .:|....|:.....|..|.|..:..:
  Fly   248 NYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPG-----QNMAASLPSQQLAEHSLNGHGPDMWS 307

  Fly   358 NHHNMG---------------GP---HPH-----------HMQQMHPMGMN--MGMGVN------ 385
            ::...|               ||   |.|           .::::.....|  :..|..      
  Fly   308 SYPKTGIYSAQEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRM 372

  Fly   386 MGMGMGMGMPIHGGGGGGGG 405
            .|.|:|:|:.  ||...|.|
  Fly   373 SGAGLGLGLT--GGAAVGVG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/86 (24%)
RRM_SF 179..257 CDD:302621 14/79 (18%)
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/82 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.