DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and rbm14b

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:172 Identity:50/172 - (29%)
Similarity:87/172 - (50%) Gaps:20/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI 151
            :|:.....|.:..|..|.|..||..:|...|.:.:|.::|.|        .||..:.|..:|.||
Zfish     1 MDKGHTVKLFVGNLALDTTQEELSAIFESYGQVVSCSVLRQF--------AFVHLQGEGAAERAI 57

  Fly   152 QKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLT 216
            ::|||...:.:.|.|..:|  |:.:..|.::|.|||.....:.|..:|..:|.:::    .||: 
Zfish    58 RELNGREFKGRNLVVEESR--GRPLHSTKVFVGNLSSMCTTEDLQELFQTFGKVLE----CDKV- 115

  Fly   217 GRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAE 258
               :|.|||....:|:|.:||:||:.|..:|  :|:.|.|::
Zfish   116 ---KGYAFVHMENKEDALQAIEALHGTSFKG--RPLSVELSK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 23/79 (29%)
RRM_SF 179..257 CDD:302621 24/77 (31%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 22/75 (29%)
RRM1_2_CoAA_like 84..149 CDD:240789 22/74 (30%)
AIR1 <150..>187 CDD:331526 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.