DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and cocoon

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:345 Identity:75/345 - (21%)
Similarity:125/345 - (36%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EGSGDN----VGRDDGT-------DDDDDSNGNMQQENGD-----GGNGGDGQEHSGDEE----Q 65
            |..||.    ...:|||       ....:|:| :|..|.|     |....:|:.:|..||    :
  Fly     8 EKEGDEPIELPAEEDGTLLLSTLQAQFPESSG-LQYRNVDTKAVRGVRSNEGRLYSPSEETGWGE 71

  Fly    66 HH------------SQDNEGNDNSAGQQQQMQQVDRTSA----TNLIINYLPQDMTDRELYNLFS 114
            :|            |:||..|..:        :..||.|    .:||:..|..:.|:::|...|.
  Fly    72 YHYFCVFPKKNKRQSEDNLENSTA--------KTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFE 128

  Fly   115 GCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDT 179
            ..|.:...:|.:|.::|:|.|:|||.:.:.......:.|.:....|...:||..:|..|.. :..
  Fly   129 TYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHSIDGRWCEVKVPASRGMGNQ-EPG 192

  Fly   180 NLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRP-RGVAFVRYNKREEAQEAIKALNNT 243
            .::|...:.:|..|.|...||.:|.::      |....:| |..:||.:            |:..
  Fly   193 KVFVGRCTEDIEADDLREYFSKFGEVI------DVFIPKPFRAFSFVTF------------LDPY 239

  Fly   244 VPEGGSQPIWVRLAEEH-----------GKAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHH 297
            ||.       |...|:|           ...|..|...|:...|...     ::.....|.|.::
  Fly   240 VPR-------VVCGEKHIIKGVSVHVSTADKKNVQNKNQLFQTNNYN-----NLDNNFKMQPANN 292

  Fly   298 HNNHHHNNHHNPHMPPHHHQ 317
            ...|..||.......||.:|
  Fly   293 FRMHPANNFSMHSFNPHGYQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/79 (25%)
RRM_SF 179..257 CDD:302621 16/78 (21%)
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 19/75 (25%)
RRM2_TDP43 193..262 CDD:240768 18/93 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.