DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and tra2b

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_957491.1 Gene:tra2b / 394172 ZFINID:ZDB-GENE-040426-1094 Length:278 Species:Danio rerio


Alignment Length:108 Identity:26/108 - (24%)
Similarity:53/108 - (49%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYA 169
            |:|:|..:||..||::...|:.|.::..|.|:..|.::...||::|.::.||..:..:|::|.|:
Zfish   135 TERDLREVFSKYGPLSDVCIVYDQQSRRSRGFALVYFENREDSKEAKERANGMELDGRRIRVDYS 199

  Fly   170 RPGGQSIKDTNLYV----------INLSRNINDDMLDRIFSPY 202
            ...|.......:|:          ::..|:..|...:|.:..|
Zfish   200 ITK
GPHTPTPGIYMGRPTYGGGPSVSRRRDSYDRGYERGYDSY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/67 (30%)
RRM_SF 179..257 CDD:302621 5/34 (15%)
tra2bNP_957491.1 RRM_TRA2B 114..202 CDD:241085 20/66 (30%)
RRM <118..>199 CDD:223796 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.