DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and pabpc1b

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_957176.1 Gene:pabpc1b / 393856 ZFINID:ZDB-GENE-050308-1 Length:634 Species:Danio rerio


Alignment Length:186 Identity:60/186 - (32%)
Similarity:102/186 - (54%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESD 146
            |:...:.::...|:.|..|.:.:.::.||:.||..|.|.:||::.| :.| |.|||||.::|:..
Zfish    88 QRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCD-ENG-SKGYGFVHFETQEA 150

  Fly   147 SEDAIQKLNG--------FYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYG 203
            :|.||:|:||        |..|.|..|...|..|.::.:.||:|:.|...:::||.|..|||.||
Zfish   151 AERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDDKLKDIFSKYG 215

  Fly   204 LIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEE 259
            ..:...::.|: .|:.||..||.:.:.|:||.|:..:|.  .|...:.|:|..|::
Zfish   216 NAMSIRVMTDE-NGKSRGFGFVSFERHEDAQRAVDEMNG--KEMNGKLIYVGRAQK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 31/87 (36%)
RRM_SF 179..257 CDD:302621 26/77 (34%)
pabpc1bNP_957176.1 PABP-1234 11..613 CDD:130689 60/186 (32%)
RRM1_I_PABPs 12..91 CDD:240824 1/2 (50%)
RRM2_I_PABPs 97..172 CDD:240825 27/76 (36%)
RRM3_I_PABPs 190..269 CDD:240826 27/82 (33%)
RRM4_I_PABPs 293..370 CDD:240827
PABP 545..612 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.