DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and hnrnpa1a

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_021335234.1 Gene:hnrnpa1a / 393467 ZFINID:ZDB-GENE-040426-1546 Length:445 Species:Danio rerio


Alignment Length:395 Identity:90/395 - (22%)
Similarity:140/395 - (35%) Gaps:109/395 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTC------------------- 122
            :|..::|....:......|.|..|..:.||..|...|...|.:..|                   
Zfish    22 TAMSKEQQTPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVSPSAAIHMLMYEREEHL 86

  Fly   123 ---------KIMRDFKTGYSFGYGFVDYKTESDSEDAI----QKLNGFYVRNKRL--KVSYARPG 172
                     ::|||..|..|.|:|||.|.:..:.:.|:    .|::|..|..||.  :...::||
Zfish    87 KVAGFLYCSQVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPG 151

  Fly   173 GQS-IKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEA 236
            ..| :|  .::|..:..:.:::.|...|..:|.|.:.||:.:|.:.:.||.||:.::..:.....
Zfish   152 AHSTVK--KMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRI 214

  Fly   237 IKALNNTVPEGGSQPIWVRLAEEH--------------GKAKAAQFMAQIGGGNGGGGGGPPHMG 287
            :....:|| .|.:..:...|:.|.              |.........:.|||.||||.|..:.|
Zfish   215 VIQKYHTV-NGHNCEVRKALSREEMNRVSMNSRGGRGGGGGSGGGNFGRGGGGGGGGGYGGGYGG 278

  Fly   288 PGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHH 352
            .||......:.....:|.:..                                           .
Zfish   279 GGGRGGGGGYGGGDGYNGYGG-------------------------------------------G 300

  Fly   353 NNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGVNMGMGMGMGMPIHGGGGGGGG-------GGGGG 410
            |..:.:....||..|::       |.|.|.|...|.|.|.|....|||.||||       |||||
Zfish   301 NGISTDKSGYGGGGPNY-------GGNRGYGSGGGGGGGGGYGNQGGGYGGGGYDNYNNNGGGGG 358

  Fly   411 GGGNF 415
            |||||
Zfish   359 GGGNF 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/113 (23%)
RRM_SF 179..257 CDD:302621 15/77 (19%)
hnrnpa1aXP_021335234.1 RRM_SF 36..144 CDD:327398 25/107 (23%)
RRM_SF 157..233 CDD:327398 16/78 (21%)
HnRNPA1 376..>392 CDD:314495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.