DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and hfp

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:288 Identity:54/288 - (18%)
Similarity:109/288 - (37%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSGDNVGRDDGTDDDDDSNG--NMQQENGDGGNGGDGQ-----------EHSGD----------- 62
            ||.|...|...:||..:.:.  ..::...|.|...|.:           :.:||           
  Fly     2 GSNDRASRSPRSDDQREISDMPATKRTRSDSGKSTDSKIPYLSQPLYDLKQTGDVKFGPGTRSAL 66

  Fly    63 ------------EEQH--------HSQDNE-----GNDNSAGQQQQM----QQVDRTSATNLI-- 96
                        .|||        ::.:..     .....|.||||:    .||.|..|..|:  
  Fly    67 LGLLGGALPKLSSEQHDLVSKAKKYAMEQSIKMVLMKQTLAHQQQQLATQRTQVQRQQALALMCR 131

  Fly    97 --INYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYV 159
              :..:..::.:..:...|:..|||.:..:..|..|....|:.||:|:....::.|::::||..:
  Fly   132 VYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGALM 196

  Fly   160 RNKRLKVSYA--RPGGQSIKD---------TNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRD 213
            ..:.:||...  .|..|.:.|         ..:||.::..:::::.:..:|..:|.|:...:.:.
  Fly   197 GGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAFGPILYCKLAQG 261

  Fly   214 KLTGRPRGVAFVRYNKREEAQEAIKALN 241
            ......:|..|:.|..::...|||.::|
  Fly   262 TSLHTHKGYGFIEYANKQAMDEAIASMN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 17/85 (20%)
RRM_SF 179..257 CDD:302621 12/63 (19%)
hfpNP_525123.2 half-pint 10..637 CDD:130706 50/280 (18%)
RRM1_PUF60 130..205 CDD:240816 15/74 (20%)
RRM2_PUF60 227..303 CDD:240817 12/63 (19%)
RRM3_UHM_PUF60 536..636 CDD:241092
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.