DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and CG4806

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster


Alignment Length:335 Identity:65/335 - (19%)
Similarity:122/335 - (36%) Gaps:93/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMQDQEHDDEQSSDIEGSGDNVGRDDGTDDDDDSNGNMQQENGDGGN--GGDGQEHSGD-EEQHH 67
            |....|..||:...:|...:|....:..::.|...|...:.:|:..:  .|:.:|.||: |::.:
  Fly   132 KNPKDEEPDEKKPKVEVKEENGDEKEVKEESDAEVGKEDESSGEDSDAESGEDEEDSGESEDEEN 196

  Fly    68 SQDNEGNDNSAGQQQQMQQVDR--------TSATNLIINYLPQDMTDRELYNLFSGCGPINTCKI 124
            .:|::.|.:....:..::.|.|        .....:.|..:|.|..|.:|.......|.::...|
  Fly   197 DEDHKENKDELKSKLDIKNVKREKQISNDVQEGCTVFIKNVPFDAEDADLRKACRKFGLVSYAII 261

  Fly   125 MRDFKTGYSFGYGFVDYKT--------------------------------------ESDSEDAI 151
            .|...:|:|.|..||.:|.                                      |:..:||.
  Fly   262 NRQAVSGHSKGTAFVKFKAKESADLCLQAGTEFKLMDEVLDPHPALSREEMKSKQSQENKKDDAK 326

  Fly   152 QKLNGFYVRN-------------------KRLKVSYARPGGQSIKDTNLYVI-------NLSRNI 190
            ...|.:..|.                   ||.::...:.  |.:|:.|.:|.       ||.:|.
  Fly   327 DSRNLYLAREGLIMAGAKAADGVSASDMAKRHELEQVKT--QVLKNLNRFVSRNRLSIHNLPQNY 389

  Fly   191 NDDMLDRI------FSPYGLIVQRNILRDKLT-----GRPRGVAFVRYNKREEAQEAIKALNNTV 244
            :::.|.::      |.|:...|.|   ..|:|     |:.:|..|:.::..:.|..|::.|||..
  Fly   390 DNEKLKQMALTYTGFRPHECRVMR---EHKVTPEHPQGKSKGFGFLSFDTHQRALAALRKLNNNP 451

  Fly   245 PEGGSQ--PI 252
            ...|:|  ||
  Fly   452 NIFGTQSRPI 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/136 (15%)
RRM_SF 179..257 CDD:302621 24/94 (26%)
CG4806NP_611955.2 RRM <2..>154 CDD:223796 6/21 (29%)
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861 14/75 (19%)
RRM4_RBM28_like 379..468 CDD:240862 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.