DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and pAbp

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:119/267 - (44%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGNGGDGQEHSGDEEQHHSQDNEGN--------------------DNSAGQQQQMQQVDRTSATN 94
            |.:.|.|..|...||..::..::.|                    :...|::.::       .||
  Fly   127 GNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKL-------FTN 184

  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNG--- 156
            :.:....:|..|.:|...|...|.|.:.|:|.. :.|.|.|:|||.::|...:|.|:|.|||   
  Fly   185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSK-EDGKSKGFGFVAFETTEAAEAAVQALNGKDM 248

  Fly   157 -----FYV--------RNKRLKVSY---ARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLI 205
                 .||        |.:.||..:   .:...:|:...||||.||...|:||.|...|||||.|
  Fly   249 GEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNI 313

  Fly   206 VQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAK---AAQ 267
            ....::.|: .||.:|..||.:|...||..|:..||..|.  ||:|::|.||:...:.|   |:|
  Fly   314 TSAKVMTDE-EGRSKGFGFVCFNAASEATCAVTELNGRVV--GSKPLYVALAQRKEERKAHLASQ 375

  Fly   268 FMAQIGG 274
            :|..:.|
  Fly   376 YMRHMTG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 28/98 (29%)
RRM_SF 179..257 CDD:302621 33/77 (43%)
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.