DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Syncrip

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001382580.1 Gene:Syncrip / 363113 RGDID:1305683 Length:623 Species:Rattus norvegicus


Alignment Length:448 Identity:85/448 - (18%)
Similarity:156/448 - (34%) Gaps:154/448 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYK 142
            :|||..:       .|.:.:..:|:|:.:.||..||...|||...::|.|..||.:.||.||.:.
  Rat   154 SGQQPSV-------GTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFC 211

  Fly   143 TESDSEDAIQKLNGFYVR------------NKRLKVS---------------------------Y 168
            |:..:::|::..|...:|            |.||.|.                           |
  Rat   212 TKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILY 276

  Fly   169 ARPGGQS------------------------------------------IKDTN---------LY 182
            .:|..:.                                          |:|.:         |:
  Rat   277 HQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLF 341

  Fly   183 VINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEG 247
            |.||:..:.:::|::.||.:|.:.:...|:|        .||:.:::|:.|.:|::.:|....||
  Rat   342 VRNLANTVTEEILEKSFSQFGKLERVKKLKD--------YAFIHFDERDGAVKAMEEMNGKDLEG 398

  Fly   248 GS-QPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGG----GPPHMGP----------GGPMHPPHH 297
            .: :.::.:..::..|.:.||..|   ..|.....    |||||.|          ||..:||.:
  Rat   399 ENIEIVFAKPPDQKRKERKAQRQA---AKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDY 460

  Fly   298 HNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHM----------QHHHPNNHNNNHPNNHHH 352
            :....:.:::.    ..:|..:..::.|.:..:...:          :...|:......|     
  Rat   461 YGYEDYYDYYG----YDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAP----- 516

  Fly   353 NNNNNNHHNMGGPHPHHMQQMHPMGMNMGM-GVNMGMGMGMGMPIHGGGGGGGGGGGG 409
            ......:...|||           |...|: |...|.....|..:.|..||.||..||
  Rat   517 PRGRAGYSQRGGP-----------GSARGVRGARGGAQQQRGRGVRGARGGRGGNVGG 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 28/118 (24%)
RRM_SF 179..257 CDD:302621 18/87 (21%)
SyncripNP_001382580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.