DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Hnrnpa3

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001104764.1 Gene:Hnrnpa3 / 362152 RGDID:727807 Length:379 Species:Rattus norvegicus


Alignment Length:390 Identity:91/390 - (23%)
Similarity:145/390 - (37%) Gaps:101/390 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GDGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGP 118
            |..|..||...:...:  ||:|....:|.:          .|.|..|..:.||..|...|...|.
  Rat     8 GRPQPDSGRRRRRRGE--EGHDPKEPEQLR----------KLFIGGLSFETTDDSLREHFEKWGT 60

  Fly   119 INTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI----QKLNGFYVRNKRL--KVSYARPGGQ-SI 176
            :..|.:|||.:|..|.|:|||.|....:.:.|:    .|::|..|..||.  :....:||.. ::
  Rat    61 LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTV 125

  Fly   177 KDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALN 241
            |  .::|..:..:..:..|...|..||.|....::.|:.:|:.||.|||.::..:...:.:....
  Rat   126 K--KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

  Fly   242 NTVPEGGSQPIWVRLAEEHGKAKAAQ---------FMAQIGGGNGGGGGGPPHMGPGGPMHPPHH 297
            :|: .|.:..:...|:::..::..:|         ||.:  |||.|||||  :.|.||       
  Rat   189 HTI-NGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGR--GGNFGGGGG--NFGRGG------- 241

  Fly   298 HNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNM 362
              |......:.                                  .....:...:...:..::..
  Rat   242 --NFGGRGGYG----------------------------------GGGGGSRGSYGGGDGGYNGF 270

  Fly   363 GGPHPHHMQQMHPMGMNMGMGVNMGM--GMGMGMPIHGGGGGGGGGGGGG----------GGGNF 415
            ||.           |.|.|.|.....  |.|.|.|.:|..|||.||||||          ||||:
  Rat   271 GGD-----------GGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNY 324

  Fly   416  415
              Rat   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/85 (31%)
RRM_SF 179..257 CDD:302621 15/77 (19%)
Hnrnpa3NP_001104764.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 8/28 (29%)
RRM1_hnRNPA_like 36..113 CDD:409992 25/76 (33%)
RRM2_hnRNPA3 126..205 CDD:409996 17/81 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 2/20 (10%)
HnRNPA1 332..>348 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.