DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and bru1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster


Alignment Length:295 Identity:66/295 - (22%)
Similarity:126/295 - (42%) Gaps:42/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HDDEQSSDIEGSGDNVGRDDGTDDDDDSN-GNMQQENGDGGNGGDGQEHSGDEEQHHSQD--NEG 73
            |.:..:..:..:.:|  ..:||..::..| ||.......||:..:.....|......:..  |..
  Fly   255 HSNNNNPSLLNNNNN--NSNGTSSNNSLNVGNNNSNPSLGGSNSNALVSVGSNGIMSAAGLVNNN 317

  Fly    74 NDNSAGQQQQMQQVD-------RTSAT-------------NLIINYLPQDMTDRELYNLFSGCGP 118
            |:..:..:..:..||       .|.||             .:.:..:|:.|.:.:|..:|...|.
  Fly   318 NNPCSANRNVVAMVDDDACFRLDTDATVTYGEKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGA 382

  Fly   119 INTCKIMRDFKTGYSFGYGFVDYKTES---DSEDA---IQKLNGFYVRNKRLKVSYARPGGQSIK 177
            :::..::||..||.|.|..||.:.|..   .::||   ::.|||.|     ..:.......::..
  Fly   383 VHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMY-----HPIQMKPADSENRN 442

  Fly   178 DTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL-- 240
            :..|:|..|::.:|::.:.::|..:|.|.:..:|||: .|:.:|.|||.:..:..|..|||..  
  Fly   443 ERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ-NGQSKGCAFVTFATKHAAISAIKVTLS 506

  Fly   241 NNTVPEGGSQPIWVRLAE---EHGKAKAAQFMAQI 272
            .|.:.||.:.|:.|:.|:   |..:.|..|..|.:
  Fly   507 QNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANL 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/98 (21%)
RRM_SF 179..257 CDD:302621 24/79 (30%)
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075 20/85 (24%)
ELAV_HUD_SF 359..808 CDD:273741 49/189 (26%)
RRM2_Bruno_like 443..524 CDD:241080 24/81 (30%)
RRM3_Bruno_like 722..800 CDD:241084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.