DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Rbp9

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:316 Identity:108/316 - (34%)
Similarity:154/316 - (48%) Gaps:30/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MQDQEHDDEQSSDIEGSGDNVGRDDGTDDDDDSNGNMQQEN-------------GDGGNGGDGQ- 57
            :|.|:.....:....|.|...|...|....::...:..|.|             |...|...|| 
  Fly     8 VQQQQQQPSGAGGASGVGSTTGSAGGPATANNVTNSQAQTNGGTTATTTAAAGAGSTTNAAVGQA 72

  Fly    58 ----EHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGP 118
                ..|.:...:::.:|..|:|:........:.|  ..||||:|||||.|:..|:.:||...|.
  Fly    73 TANNAASNNNNNNNNTNNNNNNNATANNNNNNEPD--PKTNLIVNYLPQTMSQDEIRSLFVSFGE 135

  Fly   119 INTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYV 183
            :.:||::||..||.|.|||||:|..:.|:|.||..|||..::||.:|||.|||..:|||..||||
  Fly   136 VESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYV 200

  Fly   184 INLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGG 248
            ..|.:|:....|:.:|||||.|:...||.|.:||..:||.|:|:::|.||..|||.||.|.|:..
  Fly   201 SGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNS 265

  Fly   249 SQPIWVRLAEEHGKAKAAQ--FMAQIGGGNGGGGGGPPHMGPGG--------PMHP 294
            ::||.|:.|......|.:.  ..|.|...|..||...|.....|        .:||
  Fly   266 TEPITVKFANNPSSNKNSMQPLAAYIAPQNTRGGRAFPANAAAGAAAAAAAAAIHP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 42/79 (53%)
RRM_SF 179..257 CDD:302621 35/77 (45%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 92/217 (42%)
RRM1_Hu 109..186 CDD:241094 39/76 (51%)
RRM2_Hu 196..274 CDD:241096 35/77 (45%)
RRM3_Hu 355..432 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439627
Domainoid 1 1.000 67 1.000 Domainoid score I3499
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.