DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and hnrnpa0a

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_997810.2 Gene:hnrnpa0a / 323529 ZFINID:ZDB-GENE-030131-2249 Length:305 Species:Danio rerio


Alignment Length:334 Identity:78/334 - (23%)
Similarity:119/334 - (35%) Gaps:103/334 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQK----LN 155
            |.:..|....||..|.|.|...|.:..|.::::.:...|..:|||.|.:..:::.|:..    |:
Zfish    12 LFVGGLNVQTTDDGLRNHFEQYGKLTDCVVVQNQQLKRSRCFGFVTYSSPDEADSAMSARPHILD 76

  Fly   156 GFYVRNKRLKVSYARPGGQS----IKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLT 216
            |   .|..||.:.||.....    .|...:::..|..:|.:|.|...||.:|.:.:..::.||.|
Zfish    77 G---NNVELKRAV
AREDAGKPEALAKVKKIFIGGLKDDIEEDHLRDCFSQFGAVEKAEVITDKET 138

  Fly   217 GRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGG 281
            |:.||..||.:...:.|.:|: .|...:..|....:...|.::..:|..::     |||.||.||
Zfish   139 GKKRGFGFVYFEDNDSADKAV-VLKFHIINGHKVEVKKALTKQEMQAAGSR-----GGGRGGRGG 197

  Fly   282 GPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNH 346
            |   .|.|.|                                                       
Zfish   198 G---RGMGRP------------------------------------------------------- 204

  Fly   347 PNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGVNMGMGMGMGMPIHGGGGGGGGGGG--- 408
              .:.:......:.|.||.               |.|.|.|.|.|     :|||.|||.|||   
Zfish   205 --QNGYGGRGGGYGNYGGG---------------GYGGNDGYGGG-----YGGGYGGGYGGGYGD 247

  Fly   409 ---GGGGGN 414
               |.||||
Zfish   248 QMEGYGGGN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 22/81 (27%)
RRM_SF 179..257 CDD:302621 19/77 (25%)
hnrnpa0aNP_997810.2 RRM1_hnRNPA0 8..86 CDD:240772 20/76 (26%)
RRM_SF 102..181 CDD:302621 20/79 (25%)
HnRNPA1 260..286 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.