DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and HNRNPAB

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:363 Identity:74/363 - (20%)
Similarity:134/363 - (36%) Gaps:56/363 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EHDDEQSSDIEGSGDNVGRDDGTDDDDDSNGNMQQENGDGGNGGDGQEHSGDEEQHHSQDNEGND 75
            |..:||..:..|:.:| |.:...:.:..:..      |.|...|.|...:...        .||.
Human     3 EAGEEQPMETTGATEN-GHEAVPEGESPAGA------GTGAAAGAGGATAAPP--------SGNQ 52

  Fly    76 NSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVD 140
            |.|...|.....:...|..:.:..|..|.:.::|.:.|:..|.:..|.|..|..||.|.|:||:.
Human    53 NGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFIL 117

  Fly   141 YKTESDSEDAI----QKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSP 201
            :|..:..|..:    .:|:|..:..|:.......|    :|  .::|..|:....::.:...|..
Human   118 FKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDP----VK--KIFVGGLNPEATEEKIREYFGE 176

  Fly   202 YGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGS-------QPIWVRLAEE 259
            :|.|....:..|....:.||..|:.:.:.|..::.::...:||  .||       ||..|...::
Human   177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV--SGSKCEIKVAQPKEVYQQQQ 239

  Fly   260 HGK-AKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNP-------HMPPHHH 316
            :|. .:..:.....|.|.||||||.....            |..:.|:.|.       :.|.:..
Human   240 YGSGGRGNRNRGNRGSGGGGGGGGQSQSW------------NQGYGNYWNQGYGYQQGYGPGYGG 292

  Fly   317 QPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNN 354
            ....|:.:..:.|...:.|  ...|:..:.....|.||
Human   293 YDYSPYGYYGYGPGYDYSQ--GSTNYGKSQRRGGHQNN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/83 (24%)
RRM_SF 179..257 CDD:302621 17/84 (20%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 15/81 (19%)
RRM1_hnRNPAB 66..145 CDD:410151 20/78 (26%)
RRM2_hnRNPAB 150..229 CDD:409997 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.