DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and elavl1a

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005171324.1 Gene:elavl1a / 30736 ZFINID:ZDB-GENE-990415-245 Length:340 Species:Danio rerio


Alignment Length:211 Identity:88/211 - (41%)
Similarity:127/211 - (60%) Gaps:0/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFV 139
            |.|.|.:..|......|.||||:|||||:|:..||.:|||..|.:.:.|::||...|:|.|||||
Zfish    16 DMSNGYEDHMADELIDSKTNLIVNYLPQNMSQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFV 80

  Fly   140 DYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGL 204
            :|...:|:|.||..|||..:::|.:|||||||...||||.|||:..|.:.:....::.:|..||.
Zfish    81 NYLNPNDAERAISTLNGLRLQSKTIKVSYARPSSDSIKDANLYISGLPKTMTQKDVEEMFGRYGR 145

  Fly   205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFM 269
            |:...:|.|:.:|..|||||:|::||.||::|||.||...|.|.::.:.|:.|....:.|..|.:
Zfish   146 IINSRVLVDQASGLSRGVAFIRFDKRAEAEDAIKDLNGQKPPGAAEQMTVKFAASPNQVKNTQVI 210

  Fly   270 AQIGGGNGGGGGGPPH 285
            .|:........|||.|
Zfish   211 PQVYHQQSRRFGGPVH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 42/79 (53%)
RRM_SF 179..257 CDD:302621 29/77 (38%)
elavl1aXP_005171324.1 ELAV_HUD_SF 31..340 CDD:273741 84/196 (43%)
RRM1_Hu 33..110 CDD:241094 38/76 (50%)
RRM2_HuR 120..203 CDD:241217 30/82 (37%)
RRM3_HuR 257..340 CDD:241097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.