DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Pabpc4

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006238860.1 Gene:Pabpc4 / 298510 RGDID:1305015 Length:660 Species:Rattus norvegicus


Alignment Length:251 Identity:70/251 - (27%)
Similarity:115/251 - (45%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157
            ||:.|....:::.|..|..|||..|...:.|:|||. :|.|.|:|||.|:...|:..|::::||.
  Rat   191 TNVYIKNFGEEVDDENLRELFSQFGKTLSVKVMRDC-SGKSKGFGFVSYEKHEDANKAVEEMNGK 254

  Fly   158 YVRNKRLKVSYARPGGQ------------------SIKDTNLYVINLSRNINDDMLDRIFSPYGL 204
            .:..|.:.|..|:...:                  ..:..|||:.||...|:|:.|.:.|||:|.
  Rat   255 EMSGKSIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGS 319

  Fly   205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKA---A 266
            |....::.:  .||.:|..||.::..|||.:|:..:|..:.  ||:|::|.||:...:.||   .
  Rat   320 ITSAKVMLE--DGRSKGFGFVCFSSPEEATKAVTEMNGRIV--GSKPLYVALAQRKEERKAHLTN 380

  Fly   267 QFMAQIGGGN-------------GGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNP 309
            |:|.::.|..             ..||...|.: |.....||::..|.......||
  Rat   381 QYMQRVAGMRALPANAILNQFQPAAGGYFVPAV-PQAQGRPPYYTPNQLAQMRPNP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 27/79 (34%)
RRM_SF 179..257 CDD:302621 27/77 (35%)
Pabpc4XP_006238860.1 PABP-1234 11..640 CDD:130689 70/251 (28%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825
RRM3_I_PABPs 190..269 CDD:240826 27/78 (35%)
RRM4_I_PABPs 293..370 CDD:240827 29/80 (36%)
PABP 572..639 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.