DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Hnrnpa1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006242446.1 Gene:Hnrnpa1 / 29578 RGDID:69234 Length:373 Species:Rattus norvegicus


Alignment Length:352 Identity:87/352 - (24%)
Similarity:129/352 - (36%) Gaps:83/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI----QKLN 155
            |.|..|..:.||..|.:.|...|.:..|.:|||..|..|.|:|||.|.|..:.:.|:    .|::
  Rat    16 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVD 80

  Fly   156 GFYVRNKRL--KVSYARPGGQ-SIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTG 217
            |..|..||.  :....|||.. ::|  .::|..:..:..:..|...|..||.|....|:.|:.:|
  Rat    81 GRVVEPKRAVSR
EDSQRPGAHLTVK--KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSG 143

  Fly   218 RPRGVAFVRYNKREEAQEAI---------------KALNNTVPEGGSQPIWVRLAEEHGKAKAAQ 267
            :.||.|||.::..:...:.:               |||:.......|       :.:.|::.:..
  Rat   144 KKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS-------SSQRGRSGSGN 201

  Fly   268 FMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLH 332
            |    |||.|||.||..:.|.||..........                                
  Rat   202 F----GGGRGGGFGGNDNFGRGGNFSGRGGFGG-------------------------------- 230

  Fly   333 HMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGV-NMGMGMGMGMPI 396
                   :.....:..:....|...|....||..|.:.......|.. |.|. |.|.|.|.....
  Rat   231 -------SRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSG-GQGYGNQGSGYGGSGSY 287

  Fly   397 ----HGGGGGGGGGGGG---GGGGNFH 416
                :||||||.|||.|   ||||:::
  Rat   288 DSYNNGGGGGGFGGGSGSNFGGGGSYN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 28/83 (34%)
RRM_SF 179..257 CDD:302621 18/92 (20%)
Hnrnpa1XP_006242446.1 RRM1_hnRNPA1 12..92 CDD:410154 26/75 (35%)
RRM2_hnRNPA3 105..184 CDD:409996 18/80 (23%)
HnRNPA1 308..345 CDD:402981 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.