DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Pabpc4l

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001099899.1 Gene:Pabpc4l / 295010 RGDID:1559517 Length:370 Species:Rattus norvegicus


Alignment Length:184 Identity:53/184 - (28%)
Similarity:98/184 - (53%) Gaps:21/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFY 158
            |:.|..|.:.:.::.||..||..|.|.:.|:|.| :.| |.|||||.|:.:..::.||:::||..
  Rat    99 NVFIKNLDKSIDNKTLYEHFSPFGKIMSSKVMTD-EEG-SKGYGFVHYQDQRAADRAIEEMNGKL 161

  Fly   159 VRNKRLKVSYARPGGQSIKD------------TNLYVINLSRNINDDMLDRIFSPYGLIVQRNIL 211
            :|:..|.|:..:    |.||            ||:|:.|...:::|:.|..:||.||..:...::
  Rat   162 LRDSTLFVARFK----SRKDREAELREKPAEFTNVYIKNFGDDMDDESLRSVFSKYGQTLSVKVM 222

  Fly   212 RDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKA 265
            :| .:|:.:...||.::..:.|:.|::.:|.....|  |.|:|..|::..:.:|
  Rat   223 KD-ASGKSKRFGFVSFDSHKAAKNAVEDMNGRDING--QTIFVGRAQKKVERQA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 27/78 (35%)
RRM_SF 179..257 CDD:302621 21/77 (27%)
Pabpc4lNP_001099899.1 ELAV_HUD_SF 11..262 CDD:273741 50/171 (29%)
RRM1_I_PABPs 11..89 CDD:240824
RRM2_I_PABPs 96..171 CDD:240825 27/73 (37%)
RRM3_I_PABPs 189..268 CDD:240826 22/81 (27%)
RRM_SF 293..369 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.