DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Pabpc6

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001099678.1 Gene:Pabpc6 / 292295 RGDID:1311201 Length:643 Species:Rattus norvegicus


Alignment Length:381 Identity:97/381 - (25%)
Similarity:156/381 - (40%) Gaps:72/381 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ENGDGGNGGDGQEHSGDEEQHHSQDNEG---NDNSAGQQQQMQQVDRTSA--------TNLIINY 99
            |||..|.|....| :.:|.:...:...|   ||......:...:.||.:.        ||:.|..
  Rat   134 ENGSKGYGFVHFE-TQEEAERAIEKMNGMFLNDRKVFVGRFKSRRDRQAELGARAKEFTNVYIKN 197

  Fly   100 LPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRL 164
            |.:||.|..|.:|||..||..:.|:|.| ::|.|.|:|||.::...|:..|:.::||..:..|::
  Rat   198 LGEDMDDERLQDLFSRFGPALSVKVMTD-ESGKSKGFGFVSFERHEDARKAVDEMNGKDLNGKQI 261

  Fly   165 KVSYAR--------------------------PGGQSIK--DTNLYVINLSRNINDDMLDRIFSP 201
            .|..|:                          |..:|::  ..||||.||...|:|:.|.:.|||
  Rat   262 YVGRAQKKVERQTELKHKFGQMKQDKPKIEQVPQDRSVRCQGVNLYVKNLDDGIDDERLRKEFSP 326

  Fly   202 YGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLA---EEHGKA 263
            :|.|....:..:  .||.:|..||.::..|||.:|:..:|..:.  .::|::|.||   ||....
  Rat   327 FGTITSAKVTME--GGRSKGFGFVCFSSPEEATKAVTEMNGRIV--ATKPLYVALAQRKEERQAH 387

  Fly   264 KAAQFMAQIGG----GNGGGGGGPPHMGPGG----PMHPPHHHNNHHHNNHHNPHMPPHHHQPQH 320
            .:.|:|.::..    .|.|.....|..|..|    ...|..:...::..|......|......|.
  Rat   388 LSNQYMQRMASTSAVPNPGINPFQPAQGLSGYFMTATAPTQNRGTYYAPNQTTQQGPSARGSAQG 452

  Fly   321 PHQHPQHHPQLHHMQHH-HPNN----HNNNHPNN----HHHNNNNNNHHNMGGPHP 367
            ...||     ..:|... ||:|    .:.:.|.:    .|...:.:.  .|.||||
  Rat   453 TRAHP-----FQNMSSAIHPSNTMPSFSTSGPTSSQAVRHRTASTST--QMMGPHP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 30/105 (29%)
RRM_SF 179..257 CDD:302621 26/77 (34%)
Pabpc6NP_001099678.1 PABP-1234 11..622 CDD:130689 97/381 (25%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825 10/38 (26%)
RRM3_I_PABPs 190..269 CDD:240826 29/79 (37%)
RRM4_I_PABPs 303..380 CDD:240827 28/80 (35%)
PABP 555..621 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.