DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Pabpc2

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001099621.1 Gene:Pabpc2 / 291615 RGDID:1310759 Length:630 Species:Rattus norvegicus


Alignment Length:264 Identity:72/264 - (27%)
Similarity:120/264 - (45%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DGGNGGDGQEHSGDEE--QHHSQDNEG---NDNS--AGQ-----QQQMQQVDRTSA-TNLIINYL 100
            :.|:.|.|..|...||  :...:...|   ||..  .||     :::.:...||.. ||:.|...
  Rat   134 ENGSKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGQFKSRKEREAELGTRTKEFTNVYIKNF 198

  Fly   101 PQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLK 165
            ...|.|:.|..||...|.:.:.|:|.| :.|.|.|:|||.::...|::.|:.::||..:..|.:.
  Rat   199 GDRMDDKTLNGLFGRFGQVLSVKVMTD-EGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIY 262

  Fly   166 VSYA------------------RPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILR 212
            |..|                  :..|...:..||||.||...|:|:.|.:.|||:|.|....::.
  Rat   263 VGPAQKKVDRHIELKRKFEQVTQDRGIRYQGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMT 327

  Fly   213 DKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKA------AQFMAQ 271
            :  .||.:|..||.::..|||.:|:..:|..:.  .::|::|.||:...:.:|      .|.||.
  Rat   328 E--GGRSKGFGFVCFSSPEEATKAVSEMNGRIV--ATKPLYVALAQRKEERQAHLTNQYIQRMAS 388

  Fly   272 IGGG 275
            :..|
  Rat   389 VRSG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/97 (26%)
RRM_SF 179..257 CDD:302621 26/77 (34%)
Pabpc2NP_001099621.1 PABP-1234 11..609 CDD:130689 72/264 (27%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..171 CDD:240825 9/36 (25%)
RRM3_I_PABPs 190..269 CDD:240826 25/79 (32%)
RRM4_I_PABPs 293..370 CDD:240827 28/80 (35%)
PABP 542..608 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.