DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and sap49

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_594001.2 Gene:sap49 / 2542426 PomBaseID:SPAC31G5.01 Length:335 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:58/184 - (31%)
Similarity:88/184 - (47%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQ 152
            ||.....:.:..|.:.:||..|:.|....||:....|.||.......|:||.::..|.|.|.|.|
pombe     6 DRNQDATIYLGNLDEKVTDSILFELCLQAGPVVNIHIPRDRVRNSHNGFGFCEFLHEQDVEYACQ 70

  Fly   153 KLNGFYVRNKRLKVSYARP--GGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQR-NILRDK 214
            .||...:..|.::|:.|..  |..::...||:|.||...:::.:|...||..|.:|:. .:.||:
pombe    71 ILNQVKLFGKPIRVNRASQDRGVNTLIGANLFVGNLDPLVDERVLYDTFSALGQLVKAPQVARDE 135

  Fly   215 LTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLA-------EEHG 261
             .||.:|..||.|:..|.|..||:|:||....  ::||.|..|       |.||
pombe   136 -NGRSKGYGFVSYDSFETADAAIEAMNNQFLM--NKPITVSYAFKREGKGERHG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 23/81 (28%)
RRM_SF 179..257 CDD:302621 28/78 (36%)
sap49NP_594001.2 RRM1_SF3B4 13..86 CDD:240780 22/72 (31%)
RRM2_SF3B4 98..179 CDD:240781 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.