DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and SPBP22H7.02c

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_595599.1 Gene:SPBP22H7.02c / 2541303 PomBaseID:SPBP22H7.02c Length:833 Species:Schizosaccharomyces pombe


Alignment Length:269 Identity:52/269 - (19%)
Similarity:101/269 - (37%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNADKMQDQE--------------HDDEQSSDIEGS----GDNVGR-------DDGT--DDDDD 38
            :||:...:::|              .||::..|:..:    ||::..       |.|.  |..:.
pombe   153 ISNSRSWENEEVFDTEITNPVIPADEDDDEYQDLPAAKRHEGDSIKSTEHDSTLDSGVVIDGREK 217

  Fly    39 SNGNMQQENGDGGNGGDGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQD 103
            |:..:.:|..:....||..::||.:.|....|:|.......:.::.|..:..|.....:....::
pombe   218 SSSELHEEESEQAAEGDTAKNSGTDAQAPLSDDEWLRLHRTRIKEKQPEEEVSVVGDELKSFDKE 282

  Fly   104 MTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDA--IQKLNGFYVRNKRLKV 166
            ..|..|..:                              |.....||  :||...        .|
pombe   283 NNDEHLERV------------------------------TNDKIADASMLQKAEN--------NV 309

  Fly   167 SYARPGGQSIKDT-NLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKR 230
            |......|.|.:| .|::.||:.:..:|.|..:|.|:|.:.|.::..||.|..|:|.|::.::  
pombe   310 SEQERNIQLISETKRLFLRNLTYSCAEDDLKSLFGPFGQLEQVHMPIDKKTNNPKGFAYIDFH-- 372

  Fly   231 EEAQEAIKA 239
             :|.:|::|
pombe   373 -DADDAVRA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 9/81 (11%)
RRM_SF 179..257 CDD:302621 19/62 (31%)
SPBP22H7.02cNP_595599.1 RRM <2..>102 CDD:223796
RRM1_MRD1 2..81 CDD:241009
RRM 232..>421 CDD:223796 39/190 (21%)
RRM2_MRD1 321..399 CDD:241010 19/63 (30%)
RRM3_MRD1 506..577 CDD:241012
ELAV_HUD_SF 508..799 CDD:273741
RRM_SF 619..702 CDD:302621
RRM5_MRD1 721..796 CDD:241014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.