DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and bru2

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:480 Identity:101/480 - (21%)
Similarity:162/480 - (33%) Gaps:108/480 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DRTSATN--LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTES---DS 147
            |:..|.|  :.:..:|:...:..|..:|...||::|..::||..|..|.|..||.|.|..   .:
  Fly   288 DQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRA 352

  Fly   148 EDA---IQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRN 209
            :||   |:.|:|.:     ..:.......::..:..|:|..|::...:..:.::|:.:|.|.:..
  Fly   353 QDALHNIKTLDGMH-----HPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECT 412

  Fly   210 ILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNT-VPEGGSQPIWVRLAEEHGKAKAAQFMAQI- 272
            :|||: .|:.:|.|||.:..::.|..|||||:.: ..||.|.|:.|:.|:.. |.|..:.|.|| 
  Fly   413 VLRDQ-AGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQ-KEKDQKKMQQIH 475

  Fly   273 --------GGGNGGGG-----------GGPPHMG------------------PGGPMHPPHHHNN 300
                    .|...|..           ..||..|                  .|.....|.....
  Fly   476 AFCGINTPSGATAGAATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVP 540

  Fly   301 HHHNNHHNPHMPPHHHQPQHPHQ-----------------HPQHHPQLH----HMQHHHPNNHNN 344
            .:.....:..:.|:.......||                 |.|.:.|||    ...|:.|.    
  Fly   541 LNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGYGLSPAHYLPG---- 601

  Fly   345 NHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGVNMGMGMGMGMPIHGGGG-------- 401
               .|.||...|:.||:...|         .:|......::.........|:  ||.        
  Fly   602 ---LNFHHPPENSAHHSQHSP---------GIGGASAASLSAAAATAASNPL--GGAPPPTPTPT 652

  Fly   402 GGGGGGGGGGGGNFHHMAHRGEVFMLPLPICSR-------FPSQPHPVGNGICHSPNKNSRFRLS 459
            ...|...|.|......|:.:..|.:|..|....       ..|..|..||....|...|.|...:
  Fly   653 SSAGHAAGAGLLAAPSMSMQNLVALLATPTAHHQLSLHHSSSSSGHNNGNSSATSGLHNQRLTYA 717

  Fly   460 RRPQASRTTIRYIAHSVADPVPTPT 484
            ..|.....:..|....:.....|||
  Fly   718 AAPPPPPISTTYNMPQLIGHTATPT 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/87 (24%)
RRM_SF 179..257 CDD:302621 25/78 (32%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 21/85 (25%)
RRM2_Bruno_like 381..461 CDD:241080 25/80 (31%)
RRM_SF 801..892 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.