DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and ELAVL4

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens


Alignment Length:254 Identity:99/254 - (38%)
Similarity:135/254 - (53%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QQENGDGGNGGDGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRE 108
            |..||...|..:|             .:..|.|.....|.....| .|.||||:|||||:||..|
Human    47 QVSNGPTSNTSNG-------------PSSNNRNCPSPMQTGATTD-DSKTNLIVNYLPQNMTQEE 97

  Fly   109 LYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGG 173
            ..:||...|.|.:||::||..||.|.|||||:|....|:|.||..|||..::.|.:|||||||..
Human    98 FRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSS 162

  Fly   174 QSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIK 238
            .||:|.||||..|.:.:....|:::||.||.|:...||.|::||..|||.|:|::||.||:||||
Human   163 ASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIK 227

  Fly   239 ALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPG----GPMH 293
            .||...|.|.::||.|:.|....:..:...::|:            :..|.    ||:|
Human   228 GLNGQKPSGATEPITVKFANNPSQKSSQALLSQL------------YQSPNRRYPGPLH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 44/79 (56%)
RRM_SF 179..257 CDD:302621 36/77 (47%)
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 90/208 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.