DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and rnp-9

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:214 Identity:56/214 - (26%)
Similarity:103/214 - (48%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVD 140
            :||.:.....::|.:...::.:..|.:|:::..|.:.|:..|.::..|::||.:|..|.|||||.
 Worm    70 HSASEPPMEMRIDTSKHFHVFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVS 134

  Fly   141 YKTESDSEDAIQKLNGFYVRNKRLKVSY-ARPGGQSIKD---------------TNLYVINLSRN 189
            :..:.::|:||..:||.::..:.::.:: ||...:..:|               |::||.|:|:.
 Worm   135 FPNKQNAENAIAGMNGKWIGKRAVRTNWAARKNSEENRDKLTFEQVFNSTKADNTSVYVGNISQQ 199

  Fly   190 INDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALN------------- 241
            ..|..|..:||.||.|.:..|.:   |.|   .|||||.|:|.|.:||..:|             
 Worm   200 TTDADLRDLFSTYGDIAEVRIFK---TQR---YAFVRYEKKECATKAIMEMNGKEMAGNQVRCSW 258

  Fly   242 ---NTVPEGGSQPIWVRLA 257
               ..||.....|:.:.|:
 Worm   259 GRTQAVPNQALNPLPIDLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 22/80 (28%)
RRM_SF 179..257 CDD:302621 29/93 (31%)
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 20/73 (27%)
RRM3_TIA1_like 189..260 CDD:240800 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.