DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and rnp-1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001256408.1 Gene:rnp-1 / 179672 WormBaseID:WBGene00004384 Length:305 Species:Caenorhabditis elegans


Alignment Length:83 Identity:19/83 - (22%)
Similarity:36/83 - (43%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157
            :.|.:..||.::...:|..:|.....:..|.|:::        |.||..: |.|.:..|.:|.|:
 Worm     3 SKLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKN--------YAFVHIE-EDDVDPIITRLTGY 58

  Fly   158 YVRNKRLKV----SYARP 171
            .:..|.:.:    |..||
 Worm    59 TIDGKVVNIKKSTSKLRP 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 19/83 (23%)
RRM_SF 179..257 CDD:302621
rnp-1NP_001256408.1 RRM <2..>83 CDD:223796 19/83 (23%)
RRM1_2_CoAA_like 4..68 CDD:240789 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.