DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and hrpa-1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001040945.1 Gene:hrpa-1 / 177101 WormBaseID:WBGene00001999 Length:347 Species:Caenorhabditis elegans


Alignment Length:396 Identity:93/396 - (23%)
Similarity:134/396 - (33%) Gaps:115/396 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DNSAGQQQQMQQVDRTSATNLIINYLPQDMTD---RELYNLFSGCGPINTCKIMRDFKTGYSFGY 136
            :|.:|.    ..::..:...:.:..|..:.||   ||.|:.|   |.|....:|||..|..|.|:
 Worm     9 ENGSGD----ASLEPENLRKIFVGGLTSNTTDDLMREFYSQF---GEITDIIVMRDPTTKRSRGF 66

  Fly   137 GFVDY--KTESDSEDAIQKLNGFYVRNKRLKVSYARP------GGQSIKDTNLYVINLSRNINDD 193
            |||.:  |||   .||..|.....:..|.:....|.|      ...::....|||..:..:..:|
 Worm    67 GFVTFSGKTE---VDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTED 128

  Fly   194 MLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAE 258
            ||...|:.||.:.:..|:.||.|.:|||..||.::..:...:.:...::.| .|....:...|::
 Worm   129 MLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV-NGHRCDVRKGLSK 192

  Fly   259 EH--------------GKAKAAQFMAQIGGGNGGGGGGPP--------HMGPGGPMHPPHHHNNH 301
            :.              |:::..|.....|||.||||.|.|        :.||||.....:...|:
 Worm   193 DEMSKAQMNRDRETRGGRSRDGQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGGNY 257

  Fly   302 HHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPH 366
                                                          ...............||| 
 Worm   258 ----------------------------------------------GGGWGQQGGGGQGGWGGP- 275

  Fly   367 PHHMQQMHPMGMNMGMGVNMGMGM------------GMGMPIHGGGGGGGGG-----GGGGGGGN 414
                ||....|   |.|...|.|.            |.|.|..||||||.||     ||.||...
 Worm   276 ----QQQQGGG---GWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWGGQSG 333

  Fly   415 FHHMAH 420
            ....||
 Worm   334 AQQWAH 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 27/90 (30%)
RRM_SF 179..257 CDD:302621 20/77 (26%)
hrpa-1NP_001040945.1 RRM1_hnRNPA_like 24..101 CDD:241022 26/82 (32%)
RRM2_hnRNPA_like 115..187 CDD:240774 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.