DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and exc-7

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_496057.1 Gene:exc-7 / 174506 WormBaseID:WBGene00001368 Length:456 Species:Caenorhabditis elegans


Alignment Length:218 Identity:90/218 - (41%)
Similarity:125/218 - (57%) Gaps:20/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLN 155
            |.||||||||||.||..|:.:||:..|.|.:||::||..||.|.|||||:|..|.|:..|:...|
 Worm    40 SKTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSFN 104

  Fly   156 GFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPR 220
            |..::||.:|||||||....||.:||||..:.:::....|:.||.|:|.|:...||.|.:||..:
 Worm   105 GLRLQNKTIKVSYARPSNDQIKGSNLYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSK 169

  Fly   221 GVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVR-------------LAEEHGKAKAAQFMAQI 272
            ||.|||::|::||..|||.||.::|.|.|:.|.|:             |::.....:||..:..:
 Worm   170 GVGFVRFDKKDEADVAIKTLNGSIPSGCSEQITVKFANNPASNNPKGLLSDLEAVQQAATTLVPL 234

  Fly   273 GGGNG-------GGGGGPPHMGP 288
            ....|       .||.||.|..|
 Worm   235 STILGAPTLRATAGGIGPMHHAP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 44/79 (56%)
RRM_SF 179..257 CDD:302621 33/90 (37%)
exc-7NP_496057.1 ELAV_HUD_SF 39..455 CDD:273741 90/218 (41%)
RRM1_Hu 41..118 CDD:241094 40/76 (53%)
RRM2_Hu 128..206 CDD:241096 33/77 (43%)
RRM3_Hu 373..449 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.