Sequence 1: | NP_569908.1 | Gene: | ssx / 31086 | FlyBaseID: | FBgn0024987 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496057.1 | Gene: | exc-7 / 174506 | WormBaseID: | WBGene00001368 | Length: | 456 | Species: | Caenorhabditis elegans |
Alignment Length: | 218 | Identity: | 90/218 - (41%) |
---|---|---|---|
Similarity: | 125/218 - (57%) | Gaps: | 20/218 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 SATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLN 155
Fly 156 GFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPR 220
Fly 221 GVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVR-------------LAEEHGKAKAAQFMAQI 272
Fly 273 GGGNG-------GGGGGPPHMGP 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssx | NP_569908.1 | RRM_SF | 93..173 | CDD:302621 | 44/79 (56%) |
RRM_SF | 179..257 | CDD:302621 | 33/90 (37%) | ||
exc-7 | NP_496057.1 | ELAV_HUD_SF | 39..455 | CDD:273741 | 90/218 (41%) |
RRM1_Hu | 41..118 | CDD:241094 | 40/76 (53%) | ||
RRM2_Hu | 128..206 | CDD:241096 | 33/77 (43%) | ||
RRM3_Hu | 373..449 | CDD:240823 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000313 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24012 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.010 |