Sequence 1: | NP_569908.1 | Gene: | ssx / 31086 | FlyBaseID: | FBgn0024987 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_599180.1 | Gene: | Pabpc1 / 171350 | RGDID: | 619838 | Length: | 636 | Species: | Rattus norvegicus |
Alignment Length: | 201 | Identity: | 61/201 - (30%) |
---|---|---|---|
Similarity: | 103/201 - (51%) | Gaps: | 26/201 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 TNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157
Fly 158 YVRNKRLKVSYA-----------RPGGQSIKD-------TNLYVINLSRNINDDMLDRIFSPYGL 204
Fly 205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKA---A 266
Fly 267 QFMAQI 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssx | NP_569908.1 | RRM_SF | 93..173 | CDD:302621 | 28/90 (31%) |
RRM_SF | 179..257 | CDD:302621 | 26/77 (34%) | ||
Pabpc1 | NP_599180.1 | PABP-1234 | 11..615 | CDD:130689 | 61/201 (30%) |
RRM1_I_PABPs | 12..91 | CDD:240824 | |||
RRM2_I_PABPs | 97..172 | CDD:240825 | |||
UNR-binding. /evidence=ECO:0000250 | 166..289 | 30/98 (31%) | |||
RRM3_I_PABPs | 190..269 | CDD:240826 | 27/78 (35%) | ||
RRM4_I_PABPs | 293..370 | CDD:240827 | 28/80 (35%) | ||
PABP | 547..614 | CDD:279051 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |