DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Rbm14

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_596879.1 Gene:Rbm14 / 170900 RGDID:620542 Length:669 Species:Rattus norvegicus


Alignment Length:190 Identity:50/190 - (26%)
Similarity:83/190 - (43%) Gaps:23/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVR-NKRLKV 166
            |.|..||..||:..|.:.:|.:|:.|        .||..:..:.:..||:.|:|..:| .:.|.|
  Rat    12 DTTPEELAALFAPYGTVMSCAVMKQF--------AFVHMRENAGAVRAIEALHGHELRPGRALVV 68

  Fly   167 SYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKRE 231
            ..:||  :.:....::|.|:|.......|..:|...|.:::.::::|        .|||...|..
  Rat    69 EMSRP--RPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKD--------YAFVHMEKEA 123

  Fly   232 EAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGG-GNGGGGGGPPHMGPGG 290
            :|:.||..||....:|  :.|.|.|:.: |:.|......|.|. ....|.|.....|.||
  Rat   124 DAKAAIAQLNGKEVKG--KRINVELSTK-GQKKGPALAIQSGDKTKKPGAGDTAFPGTGG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/70 (30%)
RRM_SF 179..257 CDD:302621 19/77 (25%)
Rbm14NP_596879.1 RRM1_CoAA 1..71 CDD:410020 19/66 (29%)
PABP-1234 <3..280 CDD:130689 50/190 (26%)
RRM2_CoAA 79..146 CDD:410021 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.