DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Elavl3

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034617.1 Gene:Elavl3 / 15571 MGIID:109157 Length:367 Species:Mus musculus


Alignment Length:195 Identity:86/195 - (44%)
Similarity:120/195 - (61%) Gaps:0/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLN 155
            |.||||:|||||:||..|..:||...|.|.:||::||..||.|.|||||:|...:|::.||..||
Mouse    37 SKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLN 101

  Fly   156 GFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPR 220
            |..::.|.:|||||||...||:|.||||..|.:.::...::::||.||.|:...||.|:.||..|
Mouse   102 GLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSR 166

  Fly   221 GVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPH 285
            ||.|:|::||.||:||||.||...|.|.::||.|:.|....:......:..:...:.....||.|
Mouse   167 GVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLH 231

  Fly   286  285
            Mouse   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 43/79 (54%)
RRM_SF 179..257 CDD:302621 35/77 (45%)
Elavl3NP_034617.1 ELAV_HUD_SF 36..366 CDD:273741 86/195 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.