DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Hnrnpab

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001041526.1 Gene:Hnrnpab / 15384 MGIID:1330294 Length:332 Species:Mus musculus


Alignment Length:368 Identity:74/368 - (20%)
Similarity:136/368 - (36%) Gaps:72/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DEQSSDIEGSGDNVGRD---DGTDDDDDSNGNMQQENGDGGNGGDGQEHSGDEEQHHSQDNEGND 75
            :||..:..|:.:| |.:   :|....:.|..........|..||.....||::     ...||:.
Mouse     6 EEQPMETTGATEN-GHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQ-----NGAEGDQ 64

  Fly    76 NSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVD 140
            .:|.:.::       .|..:.:..|..|.:.::|.:.|:..|.:..|.|..|..||.|.|:||:.
Mouse    65 INASKNEE-------DAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFIL 122

  Fly   141 YKTESDSEDAI----QKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSP 201
            :|..|..|..:    .:|:|..:..|:.......|    :|  .::|..|:....::.:...|..
Mouse   123 FKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDP----VK--KIFVGGLNPEATEEKIREYFGQ 181

  Fly   202 YGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGS-------QPIWVRLAEE 259
            :|.|....:..|....:.||..|:.:.:.:..::.::...:||  .||       ||..|...::
Mouse   182 FGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTV--SGSKCEIKVAQPKEVYQQQQ 244

  Fly   260 HGKAKAAQFMAQIGG------GNGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNP-------HM 311
            :|.          ||      ||.|.|||.....            |..:.|:.|.       :.
Mouse   245 YGS----------GGRGNRNRGNRGSGGGQSQSW------------NQGYGNYWNQGYGYQQGYG 287

  Fly   312 PPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNN 354
            |.:......|:.:..:.|...:.|  ...|:..:.....|.||
Mouse   288 PGYGGYDYSPYGYYGYGPGYDYSQ--GSTNYGKSQRRGGHQNN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/83 (25%)
RRM_SF 179..257 CDD:302621 16/84 (19%)
HnrnpabNP_001041526.1 CBFNT 1..75 CDD:285369 15/81 (19%)
RRM1_hnRNPAB 76..150 CDD:241201 20/73 (27%)
RRM2_hnRNPAB 155..234 CDD:241028 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.