DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and HNRNPA0

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_006796.1 Gene:HNRNPA0 / 10949 HGNCID:5030 Length:305 Species:Homo sapiens


Alignment Length:375 Identity:79/375 - (21%)
Similarity:120/375 - (32%) Gaps:122/375 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI 151
            ::.:....|.|..|....::..|...|...|.:..|.::.:.:|..|..:|||.|....:::.|:
Human     1 MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAM 65

  Fly   152 ----QKLNGFYVRNKRL--KVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNI 210
                ..::|..|..||.  :...||||..: |...|:|..|..::.:..|...||.:|.:.:..|
Human    66 AASPHAVDGNTVELKRAVSREDSARPGAHA-KVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEI 129

  Fly   211 LRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGG 275
            :.||.:|:.||..||.:...:.|.:|  |:....|..|.:.          :.|.|.....|..|
Human   130 IADKQSGKKRGFGFVYFQNHDAADKA--AVVKFHPIQGHRV----------EVKKAVPKEDIYSG 182

  Fly   276 NGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPN 340
            .||||......|.||                                                 .
Human   183 GGGGGSRSSRGGRGG-------------------------------------------------R 198

  Fly   341 NHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGVNMGMGMGMGMPIHGGGGGG-- 403
            ........|.........:::.||                     .|.|.|.|...:||||||  
Human   199 GRGGGRDQNGLSKGGGGGYNSYGG---------------------YGGGGGGGYNAYGGGGGGSS 242

  Fly   404 ----------------------------GGGGGGGG---GGNFHHMAHRG 422
                                        ||||||||   ||..:...:||
Human   243 YGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/85 (25%)
RRM_SF 179..257 CDD:302621 20/77 (26%)
HNRNPA0NP_006796.1 RRM1_hnRNPA0 5..83 CDD:240772 18/77 (23%)
RRM2_hnRNPA0 99..178 CDD:241023 22/90 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 10/88 (11%)
HnRNPA1 255..>269 CDD:314495 0/13 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..305 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.